PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 298aa    MW: 34077.3 Da    PI: 5.4937
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591215.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-131156146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ v+++G+++W++I ++  + Rt+k+c++rw +
   XP_013591215.1 11 KGPWKAEEDEVLINHVNRYGPRDWSSIRSKGLLQRTGKSCRLRWVN 56
                     79*************************8887799**********87 PP

2Myb_DNA-binding445.2e-1467106344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+   +++ +++G++ W++Ia +++ gRt++++k++w
   XP_013591215.1  67 KFSAEEERTVIELQAEFGNK-WARIATHLP-GRTDNDVKNFW 106
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-22459IPR009057Homeodomain-like
PROSITE profilePS5129420.712662IPR017930Myb domain
SuperFamilySSF466896.74E-289106IPR009057Homeodomain-like
SMARTSM007171.0E-101060IPR001005SANT/Myb domain
PfamPF002491.7E-111156IPR001005SANT/Myb domain
CDDcd001671.50E-101358No hitNo description
Gene3DG3DSA:1.10.10.603.3E-1960112IPR009057Homeodomain-like
PROSITE profilePS5129418.54663114IPR017930Myb domain
SMARTSM007175.8E-1364112IPR001005SANT/Myb domain
PfamPF002496.5E-1367106IPR001005SANT/Myb domain
CDDcd001679.02E-1167106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEAVKKEEIK KGPWKAEEDE VLINHVNRYG PRDWSSIRSK GLLQRTGKSC RLRWVNKLRP  60
NLKSGCKFSA EEERTVIELQ AEFGNKWARI ATHLPGRTDN DVKNFWSSRV KRLARILHNS  120
SDASTSPKPP SRRNKGKIVK PIQYFYPPQS FGLVEEEVTT ASSSSSKILP YSSSDQVDEA  180
LRLPELGIKL EHQPFAFWTD DPLMSEPHIA NQQATIPFYP ESRELLARLD NPYYYDILGP  240
AGCSEPLFAL PQPFFELPPA ERRCTHVSKD DDEEEADVFL DDFPADMFDQ VDDPNQSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-27811224126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591215.10.0PREDICTED: transcription factor MYB57-like
TrEMBLA0A0D3CUY60.0A0A0D3CUY6_BRAOL; Uncharacterized protein
STRINGBra003413.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-145MYB family protein